PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0746s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 359aa    MW: 39173.2 Da    PI: 8.8935
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0746s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.27.8e-54241511128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg
  SapurV1A.0746s0010.1.p  24 LPPGFRFHPTDEELVVHYLKKKTASAPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATG 109
                             79****************************.88***************988899********************************* PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +dk+vls+ ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  SapurV1A.0746s0010.1.p 110 TDKPVLSSgGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 151
                             *******977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6420185IPR003441NAC domain
PROSITE profilePS5100561.92524185IPR003441NAC domain
PfamPF023654.3E-2825151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MESTDSSTGG AGGGDRPVSQ QPILPPGFRF HPTDEELVVH YLKKKTASAP LPVAIIAEVD  60
LYKFDPWELP AKATFGEQEW YFFSPRDRKY PNGARPNRAA TSGYWKATGT DKPVLSSGGT  120
QKVGVKKALV FYGGKPPKGI KTNWIMHEYR LVDNKINNKP PGCDLGNKKN SLRLDDWVLC  180
RIYKKNNTQR PMDHDKDDSM DDVLGSIPPS ISVGSHQNGI LHLAKGTNFG ALLDNDQNLF  240
EGIIGSSDGI RSSSSSISHM ASPVISKPDL PMLPPKRTHP SLYWTGEDMA GSSSSKRFQG  300
GMINGDEIAV STDGNSSVST LLGQLPQTPQ LHQQTMLGSM GDGVFRPSYQ IPNMHWYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-73151876170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006370307.10.0no apical meristem family protein
SwissprotQ9LD441e-126NAC56_ARATH; NAC transcription factor 56
TrEMBLB9N1L10.0B9N1L1_POPTR; No apical meristem family protein
STRINGPOPTR_0001s41490.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-112NAC domain containing protein 2